PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943933.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 269aa    MW: 31089.1 Da    PI: 5.5532
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943933.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.35.4e-48111373128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                     pGfrFhPt+eel+++yLk+ + gkkl++ ++i ++++y+++Pw+Lp  ++ +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d+++ s+  
  XP_010943933.1  11 PGFRFHPTEEELLDYYLKRVALGKKLNF-DIIGTLNLYRHDPWELPGLARIGEREWYFFVPRDRKSGNGGRPNRTTERGFWKATGSDRPIRSAad 104
                     9*************************99.99***************8778899**************************************9877 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++l+glkktLvfy+grap+g++tdWvm+eyrl
  XP_010943933.1 105 PRRLIGLKKTLVFYEGRAPRGTRTDWVMNEYRL 137
                     7788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.29161IPR003441NAC domain
SuperFamilySSF1019416.8E-5810161IPR003441NAC domain
PfamPF023656.4E-2511137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MERSGSEMEL PGFRFHPTEE ELLDYYLKRV ALGKKLNFDI IGTLNLYRHD PWELPGLARI  60
GEREWYFFVP RDRKSGNGGR PNRTTERGFW KATGSDRPIR SAADPRRLIG LKKTLVFYEG  120
RAPRGTRTDW VMNEYRLPDA PPSNNAATPK EDIVLCKIYR KATSLKELEQ RAAMGEDMRA  180
PQACMSMVDN ASSDDQENYQ SSSLPLDNGD PKEMKEETQK EVEVTSISIR QVDLPLPELQ  240
VPKYSLDWMQ DPFSTQLRSP WLDQWLPNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-521116719171NO APICAL MERISTEM PROTEIN
1ut4_B2e-521116719171NO APICAL MERISTEM PROTEIN
1ut7_A2e-521116719171NO APICAL MERISTEM PROTEIN
1ut7_B2e-521116719171NO APICAL MERISTEM PROTEIN
3swm_A3e-521116722174NAC domain-containing protein 19
3swm_B3e-521116722174NAC domain-containing protein 19
3swm_C3e-521116722174NAC domain-containing protein 19
3swm_D3e-521116722174NAC domain-containing protein 19
3swp_A3e-521116722174NAC domain-containing protein 19
3swp_B3e-521116722174NAC domain-containing protein 19
3swp_C3e-521116722174NAC domain-containing protein 19
3swp_D3e-521116722174NAC domain-containing protein 19
4dul_A2e-521116719171NAC domain-containing protein 19
4dul_B2e-521116719171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943933.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW57e-58NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLM0RNG21e-135M0RNG2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P01320_0011e-134(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.15e-96NAC domain containing protein 36